PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 1014aa    MW: 112011 Da    PI: 4.7361
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0232genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.2e-193985148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av+q+ g++Wk+Ia+++   Rt+ qc +rwqk+l
      Gh_D07G0232 39 KGQWTPEEDEILRKAVQQFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 85
                     799****************************9.************986 PP

2Myb_DNA-binding67.13e-2191137148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEdel++++v+++G+++W+tIa++++ gR +kqc++rw+++l
      Gh_D07G0232  91 KGPWSKEEDELIIELVNKFGPKNWSTIAQHLP-GRIGKQCRERWHNHL 137
                      79******************************.*************97 PP

3Myb_DNA-binding49.97.2e-16143185145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+  ++ ++ gRt++ +k++w+
      Gh_D07G0232 143 KEAWTQEEELALIRAHQVYGNK-WAELSKFLP-GRTDNAIKNHWN 185
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.8263485IPR017930Myb domain
SuperFamilySSF466897.9E-193799IPR009057Homeodomain-like
SMARTSM007173.4E-163887IPR001005SANT/Myb domain
PfamPF002491.5E-163985IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-244196IPR009057Homeodomain-like
CDDcd001679.48E-154285No hitNo description
PROSITE profilePS5129433.06786141IPR017930Myb domain
SuperFamilySSF466891.76E-3288184IPR009057Homeodomain-like
SMARTSM007173.9E-2090139IPR001005SANT/Myb domain
PfamPF002496.1E-2091137IPR001005SANT/Myb domain
CDDcd001671.12E-1793137No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2897140IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-22141192IPR009057Homeodomain-like
SMARTSM007179.1E-16142190IPR001005SANT/Myb domain
PROSITE profilePS5129420.316142192IPR017930Myb domain
PfamPF002493.5E-14143186IPR001005SANT/Myb domain
CDDcd001673.17E-12145185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1014 aa     Download sequence    Send to blast
MDGDRTISTP SVVPSISDGA QRMRAFHGRT SGPTRRSTKG QWTPEEDEIL RKAVQQFKGK  60
NWKKIAECFK DRTDVQCLHR WQKVLNPELV KGPWSKEEDE LIIELVNKFG PKNWSTIAQH  120
LPGRIGKQCR ERWHNHLNPA INKEAWTQEE ELALIRAHQV YGNKWAELSK FLPGRTDNAI  180
KNHWNSSVKK KVDSYVASGL LEQFQFPLLT NQSQSMPSSS SRIQRNVDDS GSKCRTEADD  240
ISKCSQEPTM AGCSQPTSDL ANAAVHTREH SHLTEISGVG KEKNSCPAPC SEEYYPSLED  300
VSFSIPEIPG EAGYSTCGDY QFGLTNLPNP SSLELGQESS GFKNHCIDTS RCHEVMNVAL  360
QTSVGLNAPT SFINTVTTSD KQEHMLITDD ECCRVLFSET VTDGCFVSED LTQGYNMVES  420
SSQASDIQKS ETGITPELQS NCPSRSEVLP TSCCQPFVSP LISVEDGTTL IYGRELGQLT  480
GQPFETQEQE LTMNVHDGFI CTSDDHTYDT DMQGRSYLDK DSPKLVPVNT FGSESNAMQT  540
CPIVDDKPNL PAEQDEGGLC YEPPRFPSLD IPFFSCDLIS SGSDKQQEYS PFGIRQLMMS  600
SMNCISPFRL SDSPLWDDSP DAKLKSAAKT FTGTPSILKK RHRDLLSPLS ERRCGKKLET  660
DMTSNLSKEF SCLDVMLDAS GTGNTSQESP SECKTKSGVF IEEKENLCQA VDQEQYNGVD  720
HTEPLDDEGQ KKDSNGINSQ GDIEKEACVT DAKDKTYANA SDKIVQRPPE VLVEHNLNDL  780
LLFSPEHVGL KADRPLLSSS TLTPRNQGLA SECFSGNACV IVSSPTPQIK NSESQSISSA  840
TLENLADNAG NGAAIENYNM FSETPLKRSI ESSSAWKSPW FINSFVPGPR IDTEITIEDI  900
GYLMSPPDRS YDAIGLMKQL SEHTAATYAD ALEVLGNETP ESIVKGRRSN NSKMDKENNQ  960
METQSHLASD ILVERRILDF SECGTPGKGT ENRKSSTAVS FSSPTSSYLL KGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-71391926159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-71391926159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437996.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_012437928.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0D2LU270.0A0A0D2LU27_G
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46742649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein